PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G0327
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 318aa    MW: 35767.9 Da    PI: 6.2372
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G0327genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.7e-152269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
      Gh_D08G0327 22 KGLWSPEEDEKLMKYMLSNGQGCWSDIARNAGLQRCGKSCRLRWINYL 69
                     678*******************************************97 PP

2Myb_DNA-binding45.71.5e-1475119147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ ++E++l+++++  lG++ W+ Ia++++ gRt++++k++w++ 
      Gh_D08G0327  75 RGAFCPQEEDLIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 119
                      788999****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-221771IPR009057Homeodomain-like
PROSITE profilePS5129417.6381769IPR017930Myb domain
SuperFamilySSF466893.4E-2820116IPR009057Homeodomain-like
SMARTSM007173.3E-112171IPR001005SANT/Myb domain
PfamPF002496.7E-142269IPR001005SANT/Myb domain
CDDcd001672.59E-92569No hitNo description
PROSITE profilePS5129423.98670124IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-2572125IPR009057Homeodomain-like
SMARTSM007171.0E-1374122IPR001005SANT/Myb domain
PfamPF002492.3E-1375119IPR001005SANT/Myb domain
CDDcd001671.76E-980117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MRKPVADPPN MGKDNNKVKL RKGLWSPEED EKLMKYMLSN GQGCWSDIAR NAGLQRCGKS  60
CRLRWINYLR PDLKRGAFCP QEEDLIIHLH SILGNRWSQI AARLPGRTDN EIKNFWNSTL  120
KKRLKTTTTT PTCSSLNNSD SISEQPRTDG VGAIFPVNEH DIDIMGASLS SSSSSPTSMS  180
YPSMVTLNQF DPFPHLNNSY DMKGSFNAPT WLTTTQGGWG EGLFYGDYGK IGLEGEFSLP  240
PLETTAAIAN NNNNSCFNNT AGEKNHGQSF KVEVDNMFGL ENNNHHWHGE SLRMGEWDFE  300
ELMDNISSFP NFLDNFHC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27201265110B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119125LKKRLKT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5824991e-108JX582499.1 Gossypium hirsutum clone NBRI_GE15336 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012473261.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0D2RSX20.0A0A0D2RSX2_G
STRINGPOPTR_0009s06630.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70772642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.15e-68myb domain protein 83